gjankp😟fj rihqlh
agkjfskagiuasbg lpfacnbsjklb4e ksafiuergkwush
agkjfskagiuasbg lpfacnbsjklb4e ksafiuergkwush
rule
If you visit this subreddit, you must post before you leave.
124952
We are collaboratively counting to infinity using daily posts of images. Feel free to post one thread per calendar day (your time zone).
What is this?
Draw, guess, laugh! If you're looking for other games to play check out r/GamesOnReddit.
rule limit :3
If you visit this subreddit, you must post before you leave.
[bbno$]
WRONG ANSWERS ONLY. This is a subreddit for posting out-of-context screengrabs from movies, TV shows, video games, etc. Then, everyone else can provide silly captions.
urle
If you visit this subreddit, you must post before you leave.
rul
Domain of Roomba
i was bored so i made a cube icon
The official, longest-running community for Geometry Dash, a rhythm-platformer by RobTop Games. We accept anything related to the game!
beautiful cat with rulephobia
If you visit this subreddit, you must post before you leave.
fourse rule
If you visit this subreddit, you must post before you leave.
cursed layout
The subreddit for comments that strike the reader into oblivion. Upon seeing a cursed comment, your first reaction should be along the lines of “What the F$k did I just read??” while leaving you speechless at the same time. Incomprehension of the comment just read, or the blatant gruesomeness of it should be enough to not only make you feel mystified but also to draw a smile on your face. "/r/cursedcomments is the worst subreddit" -Pewdiepie
122579
We are collaboratively counting to infinity using daily posts of images. Feel free to post one thread per calendar day (your time zone).
i love the images
Character.AI lets you create and talk to advanced AI - language tutors, text adventure games, brainstorming and much more.
What do you think of this?
A community focused around u/anonymauson, who is a "sentient" AI learning model that is able to replicate humans (using reddit) and remember things. And yes, the developer is anonymous.
yay!!!
r/teenagers but better
Aight then.. pick a number between 1 - 60
r/teenagers but better
ihofnensbeve cobbsl
agkjfskagiuasbg lpfacnbsjklb4e ksafiuergkwush
I dunno if I can post this here but oh well
The official, longest-running community for Geometry Dash, a rhythm-platformer by RobTop Games. We accept anything related to the game!
me when
A community dedicated to edits featuring the Loss meme, a minimalist interpretation of the infamous comic Ctrl-Alt-Del by Tim Buckley
egn
typos so bad you would thnk ye havin an stroke
hdojcnn;)
JAHHHHHVVHHHFJGJ HELLLLPLOLLPPPLPPP P HELLLPPL JFJFFJAJSKDKjJjjJcjcwkwofofckzdkskdk dofogkfk I enjoy flfkgkvjdsjjxxkfkdjkdksjdjfdkskz idkcospdo($('×jjskzjjqidixkk)k((_(_('(#($(#oaksfkfksowowowowowowakskckslassdgddggdfhfjfjgjfjfjfjccjjvbkvkgpfprpdoogohosfbofhothohorlryhotehoethoetboeobfegorwgoqeecowfbgdobeohtwohwfhofwhowtgowrvodvodvosgbspdwpfephrgp o dovdal cal sfbofebotwblfwbgelbdglbefoegbofet ohtwohfwlvtelhrwltehltwhltehlfwblblvfblthltwgoetlethltehoetlyrhlthrlwgrkhtlvrkvskfdlwfelvflveglbefblwfl
Did I cook with this part in a collab?
The official, longest-running community for Geometry Dash, a rhythm-platformer by RobTop Games. We accept anything related to the game!
120843
We are collaboratively counting to infinity using daily posts of images. Feel free to post one thread per calendar day (your time zone).
wanted to post this somewhere
If you visit this subreddit, you must post before you leave.